Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mutT protein

This E. coli mutT protein spans the amino acid sequence from region 1-129aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

7,8-dihydro-8-oxoguanine-triphosphatase, Mutator protein MutTdGTP pyrophosphohydrolase

UniProt

P08337

Expression Region

1-129aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A6 Antibody, Biotin conjugated
A61372-50UG 50 µg

SLC38A6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ETP-46464 10mg
A13328-10 10 mg

ETP-46464 10mg

Sign In for Pricing
View Details
(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt
QZB52713-01 0.25 g

(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt

Sign In for Pricing
View Details
(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt
QZB52713-02 0.5 g

(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt

Sign In for Pricing
View Details
(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt
QZB52713-03 1 g

(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt

Sign In for Pricing
View Details
(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt
QZB52713-04 2 g

(5-Methyl-[1,3,4]oxadiazol-2-yl) -acetic acid potassium salt

Sign In for Pricing
View Details