Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ms4a1 protein

This Mouse Ms4a1 protein spans the amino acid sequence from region 132-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20

UniProt

P19437

Expression Region

132-291aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Classic rack 16 boxes 32mm, 572x140x140mm, w/locking rod
TE21358 1 Piece

Classic rack 16 boxes 32mm, 572x140x140mm, w/locking rod

Sign In for Pricing
View Details
Chromogranin A Rabbit Monoclonal Antibody
AMRe21490-01 50 µL

Chromogranin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Chromogranin A Rabbit Monoclonal Antibody
AMRe21490-02 100 µL

Chromogranin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Chromogranin A Rabbit Monoclonal Antibody
AMRe21490-03 200 µL

Chromogranin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti SP1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAMLSP1AP069120UL 120 µL

Rabbit Anti SP1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
TSC2, Phosphorylated (S1096) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 490)
MBS6359293-01 0.1 mL

TSC2, Phosphorylated (S1096) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 490)

Sign In for Pricing
View Details