Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCER1G protein

This Human FCER1G protein spans the amino acid sequence from region 45-86aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc receptor gamma-chain , FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma , FceRI gamma

UniProt

P30273

Expression Region

45-86aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
E-UNEL-M0084-01 5x 96 Tests

Uncoated Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
E-UNEL-M0084-02 15x 96 Tests

Uncoated Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF405S conjugate, 0.1mg/mL
BNC041372-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Chloro-N,N-diethylethylamine Hydrochloride
TRC-C421850-25G 25 g

2-Chloro-N,N-diethylethylamine Hydrochloride

Sign In for Pricing
View Details
Human CTSL (Cathepsin L) ELISA Kit
E-EL-H0671-01 24 Tests

Human CTSL (Cathepsin L) ELISA Kit

Sign In for Pricing
View Details
Human CTSL (Cathepsin L) ELISA Kit
E-EL-H0671-02 48 Tests

Human CTSL (Cathepsin L) ELISA Kit

Sign In for Pricing
View Details