Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCER1G protein

This Human FCER1G protein spans the amino acid sequence from region 45-86aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc receptor gamma-chain , FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma , FceRI gamma

UniProt

P30273

Expression Region

45-86aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-D-Glucosamine 6-Acetate
TRC-A178205-50MG 50 mg

N-Acetyl-D-Glucosamine 6-Acetate

Sign In for Pricing
View Details
Mif (BC024895) Mouse Tagged ORF Clone
MG200478 10 µg

Mif (BC024895) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF405S conjugate, 0.1mg/mL
BNC042336-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse GHR Antibody Pair Set
E-KAB-0347 50 µL & 100 µg

Mouse GHR Antibody Pair Set

Sign In for Pricing
View Details
Adenylate Kinase 1 (AK1) (NM_000476) Human Over-expression Lysate
LY400171 100 µg

Adenylate Kinase 1 (AK1) (NM_000476) Human Over-expression Lysate

Sign In for Pricing
View Details
P24-HIV (p24/661), CF640R conjugate, 0.1mg/mL
BNC400661-100 1x 100 µL

P24-HIV (p24/661), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details