Human FCER1G protein
This Human FCER1G protein spans the amino acid sequence from region 45-86aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fc receptor gamma-chain , FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma , FceRI gamma
UniProt
P30273
Expression Region
45-86aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
6.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Cytoplasmic Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-CL-H0893-01 24 Tests
Human ALDOC (Aldolase C, Fructose Bisphosphate) CLIA Kit
Sign In for Pricing
View Details E-CL-H0893-02 48 Tests
Human ALDOC (Aldolase C, Fructose Bisphosphate) CLIA Kit
Sign In for Pricing
View Details E-CL-H0893-03 96 Tests
Human ALDOC (Aldolase C, Fructose Bisphosphate) CLIA Kit
Sign In for Pricing
View Details 
TP762354 50 µg
Neurofilament (NEFL) (NM_006158) Human Recombinant Protein
Sign In for Pricing
View Details