Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBS protein

This Human CBS protein spans the amino acid sequence from region 1-413aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase, Serine sulfhydrase

UniProt

P35520

Expression Region

1-413aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTB Monoclonal Antibody
CSB-MA000091M1m-01 50 μL

ACTB Monoclonal Antibody

Sign In for Pricing
View Details
ACTB Monoclonal Antibody
CSB-MA000091M1m-02 100 µL

ACTB Monoclonal Antibody

Sign In for Pricing
View Details
SSX4 (NM_005636) Human Over-expression Lysate
LS006759-20ug 20 µg

SSX4 (NM_005636) Human Over-expression Lysate

Sign In for Pricing
View Details
hsa-miR-4789-3p miRNA Mimic
MBS8299740-01 5 nmol

hsa-miR-4789-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4789-3p miRNA Mimic
MBS8299740-02 10 nmol

hsa-miR-4789-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4789-3p miRNA Mimic
MBS8299740-03 5x 10 nmol

hsa-miR-4789-3p miRNA Mimic

Sign In for Pricing
View Details