Virus Hirudo medicinalis Hirudin variant-1 protein
This Virus Hirudo medicinalis Hirudin variant-1 protein spans the amino acid sequence from region 1-65aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hirudin variant-1, Hirudin-1, Hirudin-I, Lepirudin
UniProt
P01050
Expression Region
1-65aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Hirudo medicinalis (Medicinal leech)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880416-100 1x 100 µL
Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 