Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli eutC protein

This E. coli eutC protein spans the amino acid sequence from region 1-295aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ethanolamine ammonia-lyase small subunit

UniProt

P19636

Expression Region

1-295aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSS Polyclonal Antibody
RD81437A-01 60 μL

CTSS Polyclonal Antibody

Sign In for Pricing
View Details
CTSS Polyclonal Antibody
RD81437A-02 120 μL

CTSS Polyclonal Antibody

Sign In for Pricing
View Details
CTSS Polyclonal Antibody
RD81437A-03 200 µL

CTSS Polyclonal Antibody

Sign In for Pricing
View Details
TRBJ1-5 3'UTR Lenti-reporter-Luc Vector
47598081 1.0 µg

TRBJ1-5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse anti-Human PD-L1 mAb
MBS8576838-01 0.05 mg

Mouse anti-Human PD-L1 mAb

Sign In for Pricing
View Details
Mouse anti-Human PD-L1 mAb
MBS8576838-02 0.1 mL (AF405L)

Mouse anti-Human PD-L1 mAb

Sign In for Pricing
View Details