What is the catalog number for Human GJA1 protein?

The catalog number for Human GJA1 protein is orb604122.

What sizes are available for Human GJA1 protein?

Human GJA1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human GJA1 protein come in?

Human GJA1 protein is available in 3 different pack sizes.

Is Human GJA1 protein in stock?

Human GJA1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human GJA1 protein

This Human GJA1 protein spans the amino acid sequence from region 233-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 Short name, Cx43 Gap junction 43KDA heart protein

UniProt

P17302

Expression Region

233-382aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI