Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human REL protein

This Human REL protein spans the amino acid sequence from region 3-616aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Avian reticuloendotheliosis , C REL, C Rel protein, c Rel proto oncogene protein, Oncogene REL , Oncogene REL avian reticuloendotheliosis, Proto-oncogene c-Rel, REL, REL_HUMAN, v rel avian reticuloendotheliosis viral oncogene homolog, v rel reticuloendotheliosis viral oncogene homolog , V rel reticuloendotheliosis viral oncogene homolog (avian)

UniProt

Q04864

Expression Region

3-616aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

82.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP11 Rabbit mAb
E2R30026 100 µL

BMP11 Rabbit mAb

Sign In for Pricing
View Details
ABHD9 rabbit pAb
ES7598-01 50 µL

ABHD9 rabbit pAb

Sign In for Pricing
View Details
ABHD9 rabbit pAb
ES7598-02 100 µL

ABHD9 rabbit pAb

Sign In for Pricing
View Details
SSTR5 sgRNA CRISPR Lentivector (Human) (Target 1)
K2291402 1.0 µg DNA

SSTR5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
pExpress-1-Nudt21 Plasmid
PVT39317 2 µg

pExpress-1-Nudt21 Plasmid

Sign In for Pricing
View Details
Recombinant Human CBX2
orb1714522-01 50 µg

Recombinant Human CBX2

Sign In for Pricing
View Details