Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1X protein

This Human MT1X protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IX , MT-IX

UniProt

P80297

Expression Region

1-59aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lycorine Hydrochloride
TRC-L487550-500MG 500 mg

Lycorine Hydrochloride

Sign In for Pricing
View Details
Recombinant Human PRAP1 Protein (His Tag)
PKSH032937-01 10 µg

Recombinant Human PRAP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PRAP1 Protein (His Tag)
PKSH032937-02 50 µg

Recombinant Human PRAP1 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Acsl1 activation kit by CRISPRa
GA201349 1 Kit

Mouse Acsl1 activation kit by CRISPRa

Sign In for Pricing
View Details
Zfp804a Mouse Gene Knockout Kit (CRISPR)
KN519989 1 Kit

Zfp804a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS634250 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details