Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1X protein

This Human MT1X protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IX , MT-IX

UniProt

P80297

Expression Region

1-59aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM17, NT (ADAM17, CSVP, TACE, Disintegrin and metalloproteinase domain-containing protein 17, Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme, CD156b) (AP)
MBS6271497-01 0.2 mL

ADAM17, NT (ADAM17, CSVP, TACE, Disintegrin and metalloproteinase domain-containing protein 17, Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme, CD156b) (AP)

Sign In for Pricing
View Details
ADAM17, NT (ADAM17, CSVP, TACE, Disintegrin and metalloproteinase domain-containing protein 17, Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme, CD156b) (AP)
MBS6271497-02 5x 0.2 mL

ADAM17, NT (ADAM17, CSVP, TACE, Disintegrin and metalloproteinase domain-containing protein 17, Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme, CD156b) (AP)

Sign In for Pricing
View Details
CPNE1 Antibody
CSB-PA005900GA01HU 100 µL

CPNE1 Antibody

Sign In for Pricing
View Details
1-Bromo-2- (3'-bromophenoxy) ethane
409050-01 100 mg

1-Bromo-2- (3'-bromophenoxy) ethane

Sign In for Pricing
View Details
1-Bromo-2- (3'-bromophenoxy) ethane
409050-02 250 mg

1-Bromo-2- (3'-bromophenoxy) ethane

Sign In for Pricing
View Details
LASS1 (CerS1, LAG1, MGC90349, UOG1, LAG1 longevity assurance homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1)
MBS621361-01 0.1 mg

LASS1 (CerS1, LAG1, MGC90349, UOG1, LAG1 longevity assurance homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1)

Sign In for Pricing
View Details