Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPA3 protein

This Human RPA3 protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Replication factor A protein 3 , RF-A protein 3

UniProt

P35244

Expression Region

1-119aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAV15 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV787798 1.0 µg DNA

TRAV15 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Homoserine/homoserine lactone efflux protein (rhtB)
MBS7028657-01 0.02 mg

Recombinant Homoserine/homoserine lactone efflux protein (rhtB)

Sign In for Pricing
View Details
Recombinant Homoserine/homoserine lactone efflux protein (rhtB)
MBS7028657-02 0.1 mg

Recombinant Homoserine/homoserine lactone efflux protein (rhtB)

Sign In for Pricing
View Details
Recombinant Homoserine/homoserine lactone efflux protein (rhtB)
MBS7028657-03 5x 0.1 mg

Recombinant Homoserine/homoserine lactone efflux protein (rhtB)

Sign In for Pricing
View Details
MTSS1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
31109124 3x 1.0µg DNA

MTSS1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Olfr1039 Double Nickase Plasmid (m2)
sc-434305-NIC-2 20 µg

Olfr1039 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details