Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPA3 protein

This Human RPA3 protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Replication factor A protein 3 , RF-A protein 3

UniProt

P35244

Expression Region

1-119aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUT (NM_001025249) Human Tagged ORF Clone
RG210600 10 µg

DUT (NM_001025249) Human Tagged ORF Clone

Sign In for Pricing
View Details
CHD2 Antibody
A17199-50UL 50 μL

CHD2 Antibody

Sign In for Pricing
View Details
Slc16a1 Rat shRNA Plasmid (Locus ID 25027)
TR709339 1 Kit

Slc16a1 Rat shRNA Plasmid (Locus ID 25027)

Sign In for Pricing
View Details
HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) (MaxLight 550)
207698-ML550 100 µL

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) (MaxLight 550)

Sign In for Pricing
View Details
LCE1E sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1200108 1.0 µg DNA

LCE1E sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Raet1l Rat shRNA Lentiviral Particle (Locus ID 292461)
TL701815V 500 µL Each

Raet1l Rat shRNA Lentiviral Particle (Locus ID 292461)

Sign In for Pricing
View Details