Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPA3 protein

This Human RPA3 protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Replication factor A protein 3 , RF-A protein 3

UniProt

P35244

Expression Region

1-119aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Bosakitug
HV243096-01 100 µg

Research Grade Bosakitug

Sign In for Pricing
View Details
Research Grade Bosakitug
HV243096-02 1 mg

Research Grade Bosakitug

Sign In for Pricing
View Details
ELF5 (NM_198381) Human Tagged Lenti ORF Clone
RC216682L4 10 µg

ELF5 (NM_198381) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DB SuperSens Taq DNA Polymerase Green
DB-1329-1kU 1 KU

DB SuperSens Taq DNA Polymerase Green

Sign In for Pricing
View Details
FOXO4 siRNA (Mouse)
orb1843742-01 15 nmol

FOXO4 siRNA (Mouse)

Sign In for Pricing
View Details
FOXO4 siRNA (Mouse)
orb1843742-02 30 nmol

FOXO4 siRNA (Mouse)

Sign In for Pricing
View Details