Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Aquaporin 1 protein

This Human Aquaporin 1 protein spans the amino acid sequence from region 220-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule

UniProt

P29972

Expression Region

220-269aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), 0.2mg/mL
BNUB1531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), 0.2mg/mL

Sign In for Pricing
View Details
(2- (Benzyloxy) -4-cyanophenyl) boronic acid
OR1038532-01 250 mg

(2- (Benzyloxy) -4-cyanophenyl) boronic acid

Sign In for Pricing
View Details
(2- (Benzyloxy) -4-cyanophenyl) boronic acid
OR1038532-02 1 g

(2- (Benzyloxy) -4-cyanophenyl) boronic acid

Sign In for Pricing
View Details
(2- (Benzyloxy) -4-cyanophenyl) boronic acid
OR1038532-03 5 g

(2- (Benzyloxy) -4-cyanophenyl) boronic acid

Sign In for Pricing
View Details
Recombinant Streptococcus thermophilus Proline--tRNA ligase (proS), partial
MBS1386968 Inquire

Recombinant Streptococcus thermophilus Proline--tRNA ligase (proS), partial

Sign In for Pricing
View Details
TGFβ RIII (A-4) Alexa Fluor® 488
sc-74511 AF488 200 µg/mL

TGFβ RIII (A-4) Alexa Fluor® 488

Sign In for Pricing
View Details