Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Aquaporin 1 protein

This Human Aquaporin 1 protein spans the amino acid sequence from region 220-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule

UniProt

P29972

Expression Region

220-269aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL24A1 CRISPR Knock Out 293T Cell Line (Human)
16570141 1x 10^6 Cells / 1.0 mL

COL24A1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Cebpd ORF Vector (Rat) (pORF)
15834016 1.0 µg DNA

Cebpd ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Tpt1 Antibody, Biotin conjugated
A37358-100UG 100 µg

Tpt1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TPD52L2 Mouse Monoclonal Antibody [Clone ID: d1C5]
SM6002S 50 µL

TPD52L2 Mouse Monoclonal Antibody [Clone ID: d1C5]

Sign In for Pricing
View Details
RPS24P13 sgRNA CRISPR Lentivector (Human) (Target 2)
K2046403 1.0 µg DNA

RPS24P13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral human EFNA5 shRNA (UAS) - Lentiviral human EFNA5 shRNA (UAS, GFP) plasmid
GTR15308677 1 Vial

Lentiviral human EFNA5 shRNA (UAS) - Lentiviral human EFNA5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details