Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Aquaporin 1 protein

This Human Aquaporin 1 protein spans the amino acid sequence from region 220-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule

UniProt

P29972

Expression Region

220-269aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Recombinant Human herpesvirus 2 gE Membrane Protein in Virus-Like PaRoom Temperatureicles (MP-VLPs)
S01YF-0622-KX145 Each

Magic™ Recombinant Human herpesvirus 2 gE Membrane Protein in Virus-Like PaRoom Temperatureicles (MP-VLPs)

Sign In for Pricing
View Details
Complement C3, C3d (Complement C3d Fragment, Complement Component C3d, C3/C3d, Complement Component 3, Complement Factor 3, CPAMD1) (FITC)
C7850-14Y-FITC 100 µL

Complement C3, C3d (Complement C3d Fragment, Complement Component C3d, C3/C3d, Complement Component 3, Complement Factor 3, CPAMD1) (FITC)

Sign In for Pricing
View Details
Human G-protein coupled receptor 124 (ADGRA2) ELISA Kit
abx525796 96 Tests

Human G-protein coupled receptor 124 (ADGRA2) ELISA Kit

Sign In for Pricing
View Details
Mrgprh (NM_030726) Mouse Tagged Lenti ORF Clone
MR220655L4 10 µg

Mrgprh (NM_030726) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Monkey Claudin 2 (CLDN2) ELISA kit
GTR10474663 96 Well

Monkey Claudin 2 (CLDN2) ELISA kit

Sign In for Pricing
View Details
HMGN2P32 Recombinant Protein (Human)
RP062937 100 µg

HMGN2P32 Recombinant Protein (Human)

Sign In for Pricing
View Details