Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CXCL8 protein

This Gallus CXCL8 protein spans the amino acid sequence from region 17-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1 , EMF-1

UniProt

P08317

Expression Region

17-102aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT3 Protein Vector (Mouse) (pPB-N-His)
PV166751 500 ng

CNOT3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit
MBS720041-01 48 Well

Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit

Sign In for Pricing
View Details
Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit
MBS720041-02 96 Well

Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit

Sign In for Pricing
View Details
Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit
MBS720041-03 5x 96 Well

Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit

Sign In for Pricing
View Details
Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit
MBS720041-04 10x 96 Well

Rabbit Perinuclear anti-neutrophil cytoplasmic antibody ELISA Kit

Sign In for Pricing
View Details
SOX13 Rabbit Polyclonal Antibody (BF350)
orb2542903 100 µL

SOX13 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details