Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CXCL8 protein

This Gallus CXCL8 protein spans the amino acid sequence from region 17-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1 , EMF-1

UniProt

P08317

Expression Region

17-102aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARGON250X26CARD-T1-P5 Pipe Markers for Gases
N004879 4 Card (4 Marker (s) x 1 Card)

ARGON250X26CARD-T1-P5 Pipe Markers for Gases

Sign In for Pricing
View Details
Dynactin subunit 2 Antibody (Fluoro647)
orb3168630 100 µg

Dynactin subunit 2 Antibody (Fluoro647)

Sign In for Pricing
View Details
RBM20 Protein Vector (Mouse) (pPM-C-HA)
PV222852 500 ng

RBM20 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Nef Antibody
orb843417 2 mg

Nef Antibody

Sign In for Pricing
View Details
Recombinant Rat Probable alcohol sulfotransferase
MBS1059336-01 0.02 mg (E-Coli)

Recombinant Rat Probable alcohol sulfotransferase

Sign In for Pricing
View Details
Recombinant Rat Probable alcohol sulfotransferase
MBS1059336-02 0.02 mg (Yeast)

Recombinant Rat Probable alcohol sulfotransferase

Sign In for Pricing
View Details