Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CXCL8 protein

This Gallus CXCL8 protein spans the amino acid sequence from region 17-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1 , EMF-1

UniProt

P08317

Expression Region

17-102aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ikarugamycin discontinued, see I2300-20
452207-01 500 µg

Ikarugamycin discontinued, see I2300-20

Sign In for Pricing
View Details
Ikarugamycin discontinued, see I2300-20
452207-02 1000 µg

Ikarugamycin discontinued, see I2300-20

Sign In for Pricing
View Details
ARFIP1 Antibody - N-terminal region : FITC (ARP73337_P050-FITC)
ARP73337_P050-FITC 100 µL

ARFIP1 Antibody - N-terminal region : FITC (ARP73337_P050-FITC)

Sign In for Pricing
View Details
POLDIP2 Polyclonal Antibody
RD88337A-01 60 μL

POLDIP2 Polyclonal Antibody

Sign In for Pricing
View Details
POLDIP2 Polyclonal Antibody
RD88337A-02 120 μL

POLDIP2 Polyclonal Antibody

Sign In for Pricing
View Details
POLDIP2 Polyclonal Antibody
RD88337A-03 200 µL

POLDIP2 Polyclonal Antibody

Sign In for Pricing
View Details