Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IFN gamma protein

This Mouse IFN gamma protein spans the amino acid sequence from region 27-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ifng, Interferon gamma, IFN-gamma

UniProt

P01580

Expression Region

27-155aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

293XL/hTLR7
293xl-htlr7 3-7 x 10e6 cells

293XL/hTLR7

Sign In for Pricing
View Details
EGF Recombinant Protein
orb1230530-01 0.1 mg

EGF Recombinant Protein

Sign In for Pricing
View Details
EGF Recombinant Protein
orb1230530-02 0.5 mg

EGF Recombinant Protein

Sign In for Pricing
View Details
Bola1 Mouse shRNA Plasmid (Locus ID 69168)
TL519364 1 Kit

Bola1 Mouse shRNA Plasmid (Locus ID 69168)

Sign In for Pricing
View Details
BEST1 Protein Vector (Human) (pPB-N-His)
PV004002 500 ng

BEST1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Alyref shRNA (UAS) - Lentiviral mouse Alyref shRNA (UAS) plasmid
GTR15209383 1 Vial

Lentiviral mouse Alyref shRNA (UAS) - Lentiviral mouse Alyref shRNA (UAS) plasmid

Sign In for Pricing
View Details