Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat IFN gamma protein

This Rat IFN gamma protein spans the amino acid sequence from region 23-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IfngInterferon gamma, IFN-gamma

UniProt

P01581

Expression Region

23-156aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 pTyr554 Rabbit Polyclonal Antibody
AP12965PU-N 400 µL

GIT1 pTyr554 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,4-Dichlorobenzyl Chloride
TRC-D432320-1G 1 g

2,4-Dichlorobenzyl Chloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS808236 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
SH3BGRL Mouse Monoclonal Antibody [Clone ID: OTI8F7]
CF809727 100 µg

SH3BGRL Mouse Monoclonal Antibody [Clone ID: OTI8F7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS517022 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Gsr Mouse Gene Knockout Kit (CRISPR)
KN307386BN 1 Kit

Gsr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details