Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus CYS4 protein

This Virus CYS4 protein spans the amino acid sequence from region 1-507aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase, Serine sulfhydrase, Sulfur transfer protein 4

UniProt

P32582

Expression Region

1-507aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVLARFDSSKLEASTTKYADVFGNATVKDLHLKPVVSVKETAKVTDVIKILKDNGFDQLPVLTEDGKLSGLVTLSELLRKLSINNSNNDNTIKGKYLDFKKLNNFNDVSSYNENKSGKKKFIKFDENSKLSDLNRFFEKNSSAVITDGLKPIHIVTKMDLLSYLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Alanine Aminotransferase (ALT)
SIPA335Ra01-01 10 µg

Recombinant Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details
Recombinant Alanine Aminotransferase (ALT)
SIPA335Ra01-02 50 µg

Recombinant Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details
Recombinant Alanine Aminotransferase (ALT)
SIPA335Ra01-03 200 µg

Recombinant Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details
Recombinant Alanine Aminotransferase (ALT)
SIPA335Ra01-04 1 mg

Recombinant Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details
Recombinant Alanine Aminotransferase (ALT)
SIPA335Ra01-05 5 mg

Recombinant Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details
Human IgE Mouse Monoclonal Antibody [Clone ID: 090-18132]
AM00919PU-N 1 mg

Human IgE Mouse Monoclonal Antibody [Clone ID: 090-18132]

Sign In for Pricing
View Details