Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLXNA1 protein

This Human PLXNA1 protein spans the amino acid sequence from region 986-1152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Semaphorin receptor NOV

UniProt

Q9UIW2

Expression Region

986-1152aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial
MBS1241516-01 0.5 mg (E-Coli)

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial

Sign In for Pricing
View Details
Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial
MBS1241516-02 0.05 mg (Baculovirus)

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial

Sign In for Pricing
View Details
Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial
MBS1241516-03 0.5 mg (Yeast)

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial

Sign In for Pricing
View Details
Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial
MBS1241516-04 0.05 mg (Mammalian-Cell)

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial

Sign In for Pricing
View Details
Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial
MBS1241516-05 1 mg (E-Coli)

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial

Sign In for Pricing
View Details
Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial
MBS1241516-06 0.1 mg (Baculovirus)

Recombinant Rat C-type lectin domain family 2 member D2 (Clec2d2), partial

Sign In for Pricing
View Details