Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLXNA1 protein

This Human PLXNA1 protein spans the amino acid sequence from region 986-1152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Semaphorin receptor NOV

UniProt

Q9UIW2

Expression Region

986-1152aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0282705 3x 1.0 µg

C11orf10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Marmoset TNF-α ELISPOT antibody pair
CT962-10 10 Plates

Marmoset TNF-α ELISPOT antibody pair

Sign In for Pricing
View Details
CD151 Human Over-expression Lysate
orb1343322 100 µg

CD151 Human Over-expression Lysate

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI9H8]
TA805497S 30 µL

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI9H8]

Sign In for Pricing
View Details
ANGEL2 Polyclonal Conjugated Antibody
C27785 100 µL

ANGEL2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Human TMEM108 (NM_001136469) AAV Particle
RC227677A1V 250 µL

Human TMEM108 (NM_001136469) AAV Particle

Sign In for Pricing
View Details