Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLXNA1 protein

This Human PLXNA1 protein spans the amino acid sequence from region 986-1152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Semaphorin receptor NOV

UniProt

Q9UIW2

Expression Region

986-1152aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0561208 1.0 µg DNA

DARC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FGF18-set siRNA/shRNA/RNAi Lentivector (Human)
20497091 4x 500 ng

FGF18-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human Rabaptin, RAB GTPase Binding Effector Protein 2 (RABEP2) ELISA Kit
abx382644 96 Tests

Human Rabaptin, RAB GTPase Binding Effector Protein 2 (RABEP2) ELISA Kit

Sign In for Pricing
View Details
Papaverine hydrochloride
B2315-250 250 mg

Papaverine hydrochloride

Sign In for Pricing
View Details
Car8 ORF Vector (Mouse) (pORF)
15029014 1.0 µg DNA

Car8 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PVRIG shRNA Plasmid (h)
sc-89650-SH 20 µg

PVRIG shRNA Plasmid (h)

Sign In for Pricing
View Details