Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GRIN2A protein

This Human GRIN2A protein spans the amino acid sequence from region 23-555aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutamate [NMDA] receptor subunit epsilon-1N-methyl D-aspartate receptor subtype 2A , NMDAR2A , NR2A , hNR2A

UniProt

Q12879

Expression Region

501-550aa&601-630aa&701-750aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AspaRoom Temperatureate Aminotransferase Matched Antibody Pair Set [ABP-S-051470]
ABP-S-051470 5 Plates

AspaRoom Temperatureate Aminotransferase Matched Antibody Pair Set [ABP-S-051470]

Sign In for Pricing
View Details
NARS Antibody
orb679766 100 µL

NARS Antibody

Sign In for Pricing
View Details
Arginine Vasopressin Receptor 1B (AVPR1B) Antibody
abx326883-01 50 µg

Arginine Vasopressin Receptor 1B (AVPR1B) Antibody

Sign In for Pricing
View Details
Arginine Vasopressin Receptor 1B (AVPR1B) Antibody
abx326883-02 100 µg

Arginine Vasopressin Receptor 1B (AVPR1B) Antibody

Sign In for Pricing
View Details
GMPPB (NM_021971) Human Untagged Clone
SC319413 10 µg

GMPPB (NM_021971) Human Untagged Clone

Sign In for Pricing
View Details
YAP1 Human shRNA Plasmid Kit (Locus ID 10413)
TF308332 1 Kit

YAP1 Human shRNA Plasmid Kit (Locus ID 10413)

Sign In for Pricing
View Details