Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBR1 protein

This Human CBR1 protein spans the amino acid sequence from region 2-277aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

15-hydroxyprostaglandin dehydrogenase [NADP (+) ] (EC, 1.1.1.197) NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductaseProstaglandin-E (2) 9-reductase (EC, 1.1.1.189) Short chain dehydrogenase/reductase family 21C member 1

UniProt

P16152

Expression Region

2-277aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Arm-PEG-Mal (MW 400)
HY-174809 1 Each

6-Arm-PEG-Mal (MW 400)

Sign In for Pricing
View Details
Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)
MBS1251622-01 0.02 mg (E-Coli)

Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)

Sign In for Pricing
View Details
Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)
MBS1251622-02 0.02 mg (Yeast)

Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)

Sign In for Pricing
View Details
Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)
MBS1251622-03 0.1 mg (E-Coli)

Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)

Sign In for Pricing
View Details
Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)
MBS1251622-04 0.1 mg (Yeast)

Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)

Sign In for Pricing
View Details
Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)
MBS1251622-05 0.02 mg (Baculovirus)

Recombinant Bovine Differentially expressed in FDCP 8 homolog (DEF8)

Sign In for Pricing
View Details