Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TROVE2 protein

This product spans the sequence region 3-535aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ro 60KDA autoantigen, Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen , SS-ATROVE domain family member 2

UniProt

P10155

Expression Region

Expression region: 3-535 AA

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Barasertib (AZD1152-HQPA)
A4112-5 5 mg

Barasertib (AZD1152-HQPA)

Sign In for Pricing
View Details
PI 3 Kinase Class 3 (PIK3C3) (AK022653) Human Untagged Clone
SC127628 10 µg

PI 3 Kinase Class 3 (PIK3C3) (AK022653) Human Untagged Clone

Sign In for Pricing
View Details
DVL1 Protein Lysate (Rat) with C-HA Tag
18743036 100 µg

DVL1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
RELA Polyclonal Antibody
MBS9131376-01 0.02 mL

RELA Polyclonal Antibody

Sign In for Pricing
View Details
RELA Polyclonal Antibody
MBS9131376-02 0.1 mL

RELA Polyclonal Antibody

Sign In for Pricing
View Details
RELA Polyclonal Antibody
MBS9131376-03 5x 0.1 mL

RELA Polyclonal Antibody

Sign In for Pricing
View Details