Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TROVE2 protein

This product spans the sequence region 3-535aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ro 60KDA autoantigen, Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen , SS-ATROVE domain family member 2

UniProt

P10155

Expression Region

Expression region: 3-535 AA

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK1/2 Antibody (YA1304)
HY-P81559 1 Each

ERK1/2 Antibody (YA1304)

Sign In for Pricing
View Details
TRNAP19 sgRNA CRISPR Lentivector (Human) (Target 3)
K2511904 1.0 µg DNA

TRNAP19 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Netrin-4 (NTN4) Antibody
orb623496 50 µg

Netrin-4 (NTN4) Antibody

Sign In for Pricing
View Details
TAT (Thrombin-Antithrombin Complex) BioAssayTM ELISA Kit (Rat) discontinued
359142-01 48 Tests

TAT (Thrombin-Antithrombin Complex) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
TAT (Thrombin-Antithrombin Complex) BioAssayTM ELISA Kit (Rat) discontinued
359142-02 96 Tests

TAT (Thrombin-Antithrombin Complex) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Anti-NAT2 antibody
STJ114639 100 µl

Anti-NAT2 antibody

Sign In for Pricing
View Details