Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TROVE2 protein

This product spans the sequence region 3-535aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ro 60KDA autoantigen, Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen , SS-ATROVE domain family member 2

UniProt

P10155

Expression Region

Expression region: 3-535 AA

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTL7B siRNA (Rat)
CRR5409-01 15 nmol

ACTL7B siRNA (Rat)

Sign In for Pricing
View Details
ACTL7B siRNA (Rat)
CRR5409-02 30 nmol

ACTL7B siRNA (Rat)

Sign In for Pricing
View Details
C2orf65 Rabbit Polyclonal Antibody (BF647)
orb2509100 100 µL

C2orf65 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
FEN1 Polyclonal Antibody, RBITC Conjugated
bs-9876R-RBITC 100 µL

FEN1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Transketolase (TKT) (NM_001135055) Human Over-expression Lysate
LC427542 20 µg

Transketolase (TKT) (NM_001135055) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine Chromatin complexes subunit BAP18 (C17orf49) ELISA kit
GTR10448529 96 Well

Canine Chromatin complexes subunit BAP18 (C17orf49) ELISA kit

Sign In for Pricing
View Details