Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSME3 protein

This Human PSME3 protein spans the amino acid sequence from region 2-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

11S regulator complex subunit gamma , REG-gammaActivator of multicatalytic protease subunit 3Ki nuclear autoantigen, Proteasome activator 28 subunit gamma , PA28g , PA28gamma

UniProt

P61289

Expression Region

2-252aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU2 (NM_001164384) Human Over-expression Lysate
LC431953 20 µg

STAU2 (NM_001164384) Human Over-expression Lysate

Sign In for Pricing
View Details
ALX4 Mouse Monoclonal Antibody [Clone ID: KAbB4]
AM05262PU-N 100 µg

ALX4 Mouse Monoclonal Antibody [Clone ID: KAbB4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS711426 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
APOL3 (NM_014349) Human Over-expression Lysate
LC429418 20 µg

APOL3 (NM_014349) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS705740 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Anti-HSD17B11
Y058740 100 µg

Anti-HSD17B11

Sign In for Pricing
View Details