Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human B7H4 protein

This Human B7H4 protein spans the amino acid sequence from region 26-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B7 homolog 4 , B7-H4B7h.5Immune costimulatory protein B7-H4Protein B7S1T-cell costimulatory molecule B7x

UniProt

Q7Z7D3

Expression Region

26-258aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GP6 Antibody Picoband® Biotin Conjugated
A02208-1-Biotin 100 µg/Vial

Anti-GP6 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)
MBS2040637-01 0.1 mL

FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)
MBS2040637-02 0.2 mL

FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)
MBS2040637-03 0.5 mL

FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)
MBS2040637-04 1 mL

FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)
MBS2040637-05 5 mL

FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details