Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGFB protein

This Human FGFB protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basic fibroblast growth factor Short name, bFGF Heparin-binding growth factor 2 Short name, HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM9B Protein Vector (Human) (pPM-C-His)
PV043080 500 ng

TMEM9B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
2-Chloro-4-ethoxy-5-methylbenzoic acid
OR1088353-01 250 mg

2-Chloro-4-ethoxy-5-methylbenzoic acid

Sign In for Pricing
View Details
2-Chloro-4-ethoxy-5-methylbenzoic acid
OR1088353-02 500 mg

2-Chloro-4-ethoxy-5-methylbenzoic acid

Sign In for Pricing
View Details
2-Chloro-4-ethoxy-5-methylbenzoic acid
OR1088353-03 1 g

2-Chloro-4-ethoxy-5-methylbenzoic acid

Sign In for Pricing
View Details
2-Chloro-4-ethoxy-5-methylbenzoic acid
OR1088353-04 5 g

2-Chloro-4-ethoxy-5-methylbenzoic acid

Sign In for Pricing
View Details
Ndufaf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K5014606 1.0 µg DNA

Ndufaf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details