Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGFB protein

This Human FGFB protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basic fibroblast growth factor Short name, bFGF Heparin-binding growth factor 2 Short name, HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG1 Recombinant Protein (Human)
RP001015 100 µg

ALG1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit anti Mouse IgE (Fc specific), conjugated with TRITC
MBS571540-01 1 mL

Rabbit anti Mouse IgE (Fc specific), conjugated with TRITC

Sign In for Pricing
View Details
Rabbit anti Mouse IgE (Fc specific), conjugated with TRITC
MBS571540-02 5x 1 mL

Rabbit anti Mouse IgE (Fc specific), conjugated with TRITC

Sign In for Pricing
View Details
HRG beta 1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-6228R-BF405-01 20 µL

HRG beta 1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
HRG beta 1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-6228R-BF405-02 100 µL

HRG beta 1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, DustyPK, HDCMD38P, KIAA0472, RIP5, RIPK5) (HRP)
245508-HRP 100 µL

DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, DustyPK, HDCMD38P, KIAA0472, RIP5, RIPK5) (HRP)

Sign In for Pricing
View Details