Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PYY protein

This Human PYY protein spans the amino acid sequence from region 31-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PYY-I

UniProt

P10082

Expression Region

31-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Recombinant Human TIMP1 protein
GR119220 5 µg

Genorise® Recombinant Human TIMP1 protein

Sign In for Pricing
View Details
Thrombospondin 4 (THBS4) Magnetic Luminex Assay Kit
LKU606385 96 Tests

Thrombospondin 4 (THBS4) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
IGHVII-1-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV764449 1.0 µg DNA

IGHVII-1-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Gprin3 ORF Vector (Mouse) (pORF)
22610014 1.0 µg DNA

Gprin3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
WFDC2 Antibody
OACA02439-50UG 50 µg

WFDC2 Antibody

Sign In for Pricing
View Details
Des (4-methylcyclohexyl) N-4-Methylphenyl-d7 Glimepiride
446169-01 1 mg

Des (4-methylcyclohexyl) N-4-Methylphenyl-d7 Glimepiride

Sign In for Pricing
View Details