Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TIMP3 protein

This Human TIMP3 protein spans the amino acid sequence from region 30-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MIG-5Tissue inhibitor of metalloproteinases 3 , TIMP-3

UniProt

P35625

Expression Region

30-208aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF440 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2706505 3x 1.0 µg

ZNF440 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g09900 Polyclonal Antibody
MBS7193890 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g09900 Polyclonal Antibody

Sign In for Pricing
View Details
Il10 (NM_012854) Rat Tagged ORF Clone Lentiviral Particle
RR210320L3V 200 µL

Il10 (NM_012854) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Med26-set siRNA/shRNA/RNAi Lentivector (Rat)
28310096 4x 500 ng

Med26-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
4933421I07Rik (m) -PR
sc-140302-PR 10 µM - 20 µL

4933421I07Rik (m) -PR

Sign In for Pricing
View Details
Rabbit Anti-Human KRT14 mAb
MA522-01 50 μL

Rabbit Anti-Human KRT14 mAb

Sign In for Pricing
View Details