Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TDGF1 protein

This Human TDGF1 protein spans the amino acid sequence from region 32-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cripto-1 growth factor , CRGFEpidermal growth factor-like cripto protein CR1

UniProt

P13385

Expression Region

32-150aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRFN4 Rabbit Polyclonal Antibody (Cy5.5)
orb1014435 100 µL

LRFN4 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Human CLN5 Protein, N-His
orb2833321-01 20 µg

Recombinant Human CLN5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CLN5 Protein, N-His
orb2833321-02 50 µg

Recombinant Human CLN5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CLN5 Protein, N-His
orb2833321-03 100 µg

Recombinant Human CLN5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri 7-cyano-7-deazaguanine synthase (queC)
MBS1071531-01 0.02 mg (E-Coli)

Recombinant Arcobacter butzleri 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri 7-cyano-7-deazaguanine synthase (queC)
MBS1071531-02 0.1 mg (E-Coli)

Recombinant Arcobacter butzleri 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details