Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TDGF1 protein

This Human TDGF1 protein spans the amino acid sequence from region 32-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cripto-1 growth factor , CRGFEpidermal growth factor-like cripto protein CR1

UniProt

P13385

Expression Region

32-150aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1E antibody (FITC)
60R-1425 100 ug

CSNK1E antibody (FITC)

Sign In for Pricing
View Details
PTPN6 Recombinant Antibody, Cy5.5 Conjugated
bsm-61171R-Cy5.5 100 µL

PTPN6 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
GTF2I CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22800154 3x 1.0 µg DNA

GTF2I CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Mmu-miR-541-5p miRNA Antagomir
orb1913479-01 10 nmol

Mmu-miR-541-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-541-5p miRNA Antagomir
orb1913479-02 20 nmol

Mmu-miR-541-5p miRNA Antagomir

Sign In for Pricing
View Details
ACIDE PHOSPHORIQUE 250X26CARD-T1-P21 Pipe Markers for Acids & Bases
N001863 4 Card (4 Marker (s) x 1 Card)

ACIDE PHOSPHORIQUE 250X26CARD-T1-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details