Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TDGF1 protein

This Human TDGF1 protein spans the amino acid sequence from region 32-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cripto-1 growth factor , CRGFEpidermal growth factor-like cripto protein CR1

UniProt

P13385

Expression Region

32-150aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPVL Rabbit mAb
E60M0942 100 µL

CPVL Rabbit mAb

Sign In for Pricing
View Details
OSTF1, NT (OSTF1, Osteoclast-stimulating factor 1) (MaxLight 405)
MBS6329784-01 0.1 mL

OSTF1, NT (OSTF1, Osteoclast-stimulating factor 1) (MaxLight 405)

Sign In for Pricing
View Details
OSTF1, NT (OSTF1, Osteoclast-stimulating factor 1) (MaxLight 405)
MBS6329784-02 5x 0.1 mL

OSTF1, NT (OSTF1, Osteoclast-stimulating factor 1) (MaxLight 405)

Sign In for Pricing
View Details
Anti-IL1A antibody (4G2) ; IgG1 Chimeric mAb
12-9494-10 10 µg

Anti-IL1A antibody (4G2) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details
Hs-746T Cells Complete Medium
MBS2568622 4x 125 mL

Hs-746T Cells Complete Medium

Sign In for Pricing
View Details
Olfr1440 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4216706 1.0 µg DNA

Olfr1440 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details