Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSS protein

This Human CTSS protein spans the amino acid sequence from region 115-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathepsin S, CathepsinS, CATS_HUMAN, Ctss

UniProt

P25774

Expression Region

115-331aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPT Antibody
orb1241415 100 µL

GPT Antibody

Sign In for Pricing
View Details
CB065 rabbit pAb
E28PT6552 100 µL

CB065 rabbit pAb

Sign In for Pricing
View Details
CHGA Rabbit Polyclonal Antibody (PE-Cy5)
orb901058 100 µL

CHGA Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Proenkephalin (PENK)
MBS2071264-01 0.1 mL

PE-Linked Polyclonal Antibody to Proenkephalin (PENK)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Proenkephalin (PENK)
MBS2071264-02 0.2 mL

PE-Linked Polyclonal Antibody to Proenkephalin (PENK)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Proenkephalin (PENK)
MBS2071264-03 0.5 mL

PE-Linked Polyclonal Antibody to Proenkephalin (PENK)

Sign In for Pricing
View Details