Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSS protein

This Human CTSS protein spans the amino acid sequence from region 115-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathepsin S, CathepsinS, CATS_HUMAN, Ctss

UniProt

P25774

Expression Region

115-331aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Filamin C Gamma (FLNC) ELISA Kit
abx515423 96 Tests

Mouse Filamin C Gamma (FLNC) ELISA Kit

Sign In for Pricing
View Details
Rat Transcription factor RelB (RELB) ELISA kit
GTR10421187 96 Well

Rat Transcription factor RelB (RELB) ELISA kit

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans arr-1 Protein (aa 1-435)
VAng-Ly3015-50gEcoli 50 µg (E. coli)

Recombinant Caenorhabditis Elegans arr-1 Protein (aa 1-435)

Sign In for Pricing
View Details
Bmp6 Mouse Gene Knockout Kit (CRISPR)
KN502199 1 Kit

Bmp6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human SOD2
MBS7613807-01 0.05 mg

Recombinant Human SOD2

Sign In for Pricing
View Details
Recombinant Human SOD2
MBS7613807-02 0.2 mg

Recombinant Human SOD2

Sign In for Pricing
View Details