Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GP73 protein

This Human GP73 protein spans the amino acid sequence from region 36-401aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Golgi membrane protein GP73Golgi phosphoprotein 2

UniProt

Q8NBJ4

Expression Region

36-401aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ckm (NM_007710) Mouse Tagged Lenti ORF Clone
MR222365L4 10 µg

Ckm (NM_007710) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TAT Polyclonal Antibody
RD84065A-01 60μL

TAT Polyclonal Antibody

Sign In for Pricing
View Details
TAT Polyclonal Antibody
RD84065A-02 120μL

TAT Polyclonal Antibody

Sign In for Pricing
View Details
TAT Polyclonal Antibody
RD84065A-03 200μL

TAT Polyclonal Antibody

Sign In for Pricing
View Details
GC Control
A23 1 Each

GC Control

Sign In for Pricing
View Details
RNF12 Polyclonal Antibody, APC-Cy7 Conjugated
bs-9177R-APC-Cy7 100 µL

RNF12 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details