Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GP73 protein

This Human GP73 protein spans the amino acid sequence from region 36-401aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Golgi membrane protein GP73Golgi phosphoprotein 2

UniProt

Q8NBJ4

Expression Region

36-401aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tra2b 3'UTR Luciferase Stable Cell Line
TU121014 1.0 mL

Tra2b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TMEM106B siRNA (h)
sc-89400 10 µM

TMEM106B siRNA (h)

Sign In for Pricing
View Details
Anti-HIF1 alpha Rabbit Polyclonal Antibody
PA1163-.05 50 µL

Anti-HIF1 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGFR2 Antibody
orb675353-01 50 µg

FGFR2 Antibody

Sign In for Pricing
View Details
FGFR2 Antibody
orb675353-02 100 µg

FGFR2 Antibody

Sign In for Pricing
View Details
GFP lentivirus (CMV, Hyg) - GFP lentivirus (CMV, Hyg)
GTR15425155 100 µL (4x 25 µL)

GFP lentivirus (CMV, Hyg) - GFP lentivirus (CMV, Hyg)

Sign In for Pricing
View Details