Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GP73 protein

This Human GP73 protein spans the amino acid sequence from region 36-401aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Golgi membrane protein GP73Golgi phosphoprotein 2

UniProt

Q8NBJ4

Expression Region

36-401aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100A8 Antibody
E55A13769 100 µg

Human S100A8 Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TMEM74 (Transmembrane protein 74) Full Length
MPC1486K Each

Magic™ Membrane Protein Human TMEM74 (Transmembrane protein 74) Full Length

Sign In for Pricing
View Details
DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (PE)
MBS6473209-01 0.2 mL

DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (PE)

Sign In for Pricing
View Details
DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (PE)
MBS6473209-02 5x 0.2 mL

DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (PE)

Sign In for Pricing
View Details
SNRPF Antibody - middle region : HRP (ARP40448_P050-HRP)
ARP40448_P050-HRP 100 µL

SNRPF Antibody - middle region : HRP (ARP40448_P050-HRP)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 (murA2)
MBS1291918-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 (murA2)

Sign In for Pricing
View Details