Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DCN protein

This Human DCN protein spans the amino acid sequence from region 20-359aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone proteoglycan IIPG-S2, PG40

UniProt

P07585

Expression Region

20-359aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFXN3 CRISPR Activation Plasmid (h2)
sc-413452-ACT-2 20 µg

SFXN3 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)
MBS1032376-01 0.02 mg (E-Coli)

Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)

Sign In for Pricing
View Details
Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)
MBS1032376-02 0.1 mg (E-Coli)

Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)

Sign In for Pricing
View Details
Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)
MBS1032376-03 0.02 mg (Yeast)

Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)

Sign In for Pricing
View Details
Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)
MBS1032376-04 0.1 mg (Yeast)

Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)

Sign In for Pricing
View Details
Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)
MBS1032376-05 0.02 mg (Baculovirus)

Recombinant Xiphias gladius Superoxide dismutase [Cu-Zn] (sod1)

Sign In for Pricing
View Details