Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANGPTL4 protein

This Human ANGPTL4 protein spans the amino acid sequence from region 28-403aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Angiopoietin-like protein 4Hepatic fibrinogen/angiopoietin-related protein , HFARP

UniProt

Q9BY76

Expression Region

28-403aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP anti-human CD45
MBS9471881-01 25 Tests

PerCP anti-human CD45

Sign In for Pricing
View Details
PerCP anti-human CD45
MBS9471881-02 100 Tests

PerCP anti-human CD45

Sign In for Pricing
View Details
PerCP anti-human CD45
MBS9471881-03 5x 100 Tests

PerCP anti-human CD45

Sign In for Pricing
View Details
ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) APC
MBS6399031-01 0.1 mL

ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) APC

Sign In for Pricing
View Details
ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) APC
MBS6399031-02 5x 0.1 mL

ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) APC

Sign In for Pricing
View Details
MMP3 (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1) (MaxLight 490) discontinued
M2421-15F-ML490 100 µL

MMP3 (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1) (MaxLight 490) discontinued

Sign In for Pricing
View Details