Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDF15 protein

This Human GDF15 protein spans the amino acid sequence from region 198-308aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage inhibitory cytokine 1 , MIC-1NSAID-activated gene 1 protein , NAG-1NSAID-regulated gene 1 protein , NRG-1, Placental TGF-betaPlacental bone morphogenetic protein, Prostate differentiation factor

UniProt

Q99988

Expression Region

198-308aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ME3 Polyclonal Antibody
PA87318HU-01 50 µg

Rabbit Anti-Human ME3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ME3 Polyclonal Antibody
PA87318HU-02 100 µg

Rabbit Anti-Human ME3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ME3 Polyclonal Antibody
PA87318HU-03 500 µg

Rabbit Anti-Human ME3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ME3 Polyclonal Antibody
PA87318HU-04 1 mg

Rabbit Anti-Human ME3 Polyclonal Antibody

Sign In for Pricing
View Details
Diopterin
T31508 25 mg

Diopterin

Sign In for Pricing
View Details
KAL1 Conjugated Antibody
MBS9445217-01 0.1 mL (Biotin)

KAL1 Conjugated Antibody

Sign In for Pricing
View Details