Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISG15 protein

This Human ISG15 protein spans the amino acid sequence from region 2-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced 15KDA proteinInterferon-induced 17KDA protein , IP17Ubiquitin cross-reactive protein

UniProt

P05161

Expression Region

2-157aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RMND5B Antibody (Biotin)
orb356420-01 50 µg

RMND5B Antibody (Biotin)

Sign In for Pricing
View Details
RMND5B Antibody (Biotin)
orb356420-02 100 µg

RMND5B Antibody (Biotin)

Sign In for Pricing
View Details
Surfactant protein D/SFTPD Rabbit Polyclonal Antibody (Cy3)
orb2620376 100 µg

Surfactant protein D/SFTPD Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
ZFP42 siRNA (Mouse)
MBS8215762-01 15 nmol

ZFP42 siRNA (Mouse)

Sign In for Pricing
View Details
ZFP42 siRNA (Mouse)
MBS8215762-02 30 nmol

ZFP42 siRNA (Mouse)

Sign In for Pricing
View Details
ZFP42 siRNA (Mouse)
MBS8215762-03 5x 30 nmol

ZFP42 siRNA (Mouse)

Sign In for Pricing
View Details